Skip to product information
1 of 1

GM-CSF, Mouse (HEK293, Fc)

GM-CSF, Mouse (HEK293, Fc)

Size

SKU:QM-0203980-01

£93.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    12981 (Gene_ID) P01587 (A18-K141) (Accession)

  • Smiles

    APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203980-01
5 µgQM-0203980-01
£93.63/ea
£0.00
£93.63/ea £0.00
10 µgQM-0203980-02
10 µgQM-0203980-02
£142.00/ea
£0.00
£142.00/ea £0.00
50 µgQM-0203980-03
50 µgQM-0203980-03
£404.78/ea
£0.00
£404.78/ea £0.00
100 µgQM-0203980-04
100 µgQM-0203980-04
£652.64/ea
£0.00
£652.64/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GM-CSF, Mouse (HEK293, Fc)

GM-CSF, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.