Skip to product information
1 of 1

GM-CSF, Mouse (His)

GM-CSF, Mouse (His)

Size

SKU:QM-0205655-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse (His) is a recombinant GM-CSF Protein expressed by E. coli with a N-6*His tag[1][2][3][4].

  • Molecular Formula

    12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

  • Smiles

    APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205655-01
2 µgQM-0205655-01
£58.12/ea
£0.00
£58.12/ea £0.00
5 µgQM-0205655-02
5 µgQM-0205655-02
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0205655-03
10 µgQM-0205655-03
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0205655-04
50 µgQM-0205655-04
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205655-05
100 µgQM-0205655-05
£448.52/ea
£0.00
£448.52/ea £0.00
500 µgQM-0205655-06
500 µgQM-0205655-06
£1,466.69/ea
£0.00
£1,466.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GM-CSF, Mouse (His)

GM-CSF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.