Skip to product information
1 of 1

GM2A, Human (HEK293, His)

GM2A, Human (HEK293, His)

Size

SKU:QM-0192204-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A catalyzes the degradation of the ganglioside GM2 as well as affects lipid storage and neuromuscular process controlling balance. GM2A Protein, Human (HEK293, His) is the recombinant human-derived GM2A protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    2760 (Gene_ID) AAH09273.1 (S32-I193) (Accession)

  • Smiles

    SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192204-01
10 µgQM-0192204-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0192204-02
50 µgQM-0192204-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GM2A, Human (HEK293, His)

GM2A, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.