Name: GMF-beta, Mouse
Brand: QuantiMol
SKU: QM-0205490-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.
Molecular Formula
63985 (Gene_ID) Q9CQI3 (S2-H142) (Accession)
Smiles
SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Purity
99
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205490-01	2 µgQM-0205490-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205490-02	10 µgQM-0205490-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0205490-03	50 µgQM-0205490-03 £362.25/ea	£0.00	Quantity	£362.25/ea	£0.00

100 µgQM-0205490-04	100 µgQM-0205490-04 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

500 µgQM-0205490-05	500 µgQM-0205490-05 £1,538.38/ea	£0.00	Quantity	£1,538.38/ea	£0.00

1 mgQM-0205490-06	1 mgQM-0205490-06 £2,579.63/ea	£0.00	Quantity	£2,579.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GMF-beta, Mouse

GMF-beta, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.