Skip to product information
1 of 1

GMFG, Human (His)

GMFG, Human (His)

Size

SKU:QM-0203715-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    9535 (Gene_ID) O60234 (S2-R142) (Accession)

  • Smiles

    SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

  • Purity

    96.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203715-01
2 µgQM-0203715-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0203715-02
10 µgQM-0203715-02
£133.00/ea
£0.00
£133.00/ea £0.00
50 µgQM-0203715-03
50 µgQM-0203715-03
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0203715-04
100 µgQM-0203715-04
£604.04/ea
£0.00
£604.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GMFG, Human (His)

GMFG, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.