GMP IL-1 alpha, Human
GMP IL-1 alpha, Human
SKU:QM-0166638
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][2]. GMP IL-1 alpha Protein, Human is a recombinant protein consisting of 153 amino acids (A117-S269) and is produced by E. coli.
-
Molecular Formula
3552 (Gene_ID) P01583 (S113-A271) (Accession)
-
Smiles
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0054296 Zuclopenthixol (-) -10-camphorsulfonic acid salt-d4
- QM-0052524 β-Nicotinamide mononucleotide, reduced form (disodium) (Standard) [CAS 108347-85-9]
- QM-0050582 β-D-Galaltosamine (hydrochloride) [CAS 14257-79-5]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0047684-01 β-D-Galactosamine pentaacetate [CAS 3006-60-8]
- QM-0023383 Withacoagin [CAS 119539-81-0]
- QM-0019988 β-Hydroxypalmitoyl-CoA [CAS 35106-50-4]
- QM-0019913 [Hydroxy (phenyl) methyl]succinyl-CoA [CAS 1383686-26-7]
- QM-0019911 [2 (R, S) -2-Sulfanylheptanoyl]-Phe-Ala-CoA
- QM-0019909 [ (2R) -3,3,4-Trimethyl-6-oxo-3,6-dihydro-1H-pyran-2-yl]acetyl-CoA
Other industry favorites
- QM-0054296 Zuclopenthixol (-) -10-camphorsulfonic acid salt-d4
- QM-0052524 β-Nicotinamide mononucleotide, reduced form (disodium) (Standard) [CAS 108347-85-9]
- QM-0150801-01 Zidesamtinib [CAS 2739829-00-4]
- QM-0150376-01 Zonampanel [CAS 210245-80-0]
- QM-0134012 α-NAD [CAS 7298-93-3]
- QM-0062648 YO-01027 (GMP) [CAS 209984-56-5]
- QM-0017969 Zonisamide-13C6
- QM-0016783 β-Hydroxydecanoyl-CoA [CAS 6245-70-1]
- QM-0182867-01 β-Alanine-pyruvate transaminase [CAS 61461-61-8]
- QM-0178574-01 β-Sitosterol acetate, 40% (contains Campesterol acetate) [CAS 915-05-9]
GMP IL-1 alpha, Human
GMP IL-1 alpha, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.