Skip to product information
1 of 1

GPA33, Human (HEK293, His)

GPA33, Human (HEK293, His)

Size

SKU:QM-0084575

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (HEK293, His) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    10223 (Gene_ID) Q99795 (I22-V235) (Accession)

  • Smiles

    ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0084575
1 EachQM-0084575
£0.00/ea
£0.00
£0.00/ea £0.00

GPA33, Human (HEK293, His)

GPA33, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.