GPA33, Human (HEK293, His)
GPA33, Human (HEK293, His)
SKU:QM-0084575
Request quote or documents

Product Details
-
Description
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (HEK293, His) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
10223 (Gene_ID) Q99795 (I22-V235) (Accession)
-
Smiles
ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
GPA33, Human (HEK293, His)
GPA33, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.