Skip to product information
1 of 1

GPHA2, Human (HEK293, His)

GPHA2, Human (HEK293, His)

Size

SKU:QM-0201026-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)

  • Smiles

    QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0201026-01
2 µgQM-0201026-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0201026-02
10 µgQM-0201026-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0201026-03
50 µgQM-0201026-03
£282.06/ea
£0.00
£282.06/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GPHA2, Human (HEK293, His)

GPHA2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.