GPX4, Human (His)

Name: GPX4, Human (His)
Brand: QuantiMol
SKU: QM-0130684-01
Price: 293.0 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0130684-01

£293.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
GPX4 Protein, Human (U73S, His) is the recombinant human-derived GPX4, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
2879 (Gene_ID) P36969-1 (C29-F197, U73S) (Accession)
Smiles
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0130684-01	20 µgQM-0130684-01 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

50 µgQM-0130684-02	50 µgQM-0130684-02 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

100 µgQM-0130684-03	100 µgQM-0130684-03 £793.58/ea	£0.00	Quantity	£793.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GPX4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.