Skip to product information
1 of 1

GRO-alpha/CXCL1, Mouse (His)

GRO-alpha/CXCL1, Mouse (His)

Size

SKU:QM-0127565

Price on request
Quantity

Request quote or documents

View full details
  • Description

    GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC (5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    14825 (Gene_ID) P12850 (N29-K96) (Accession)

  • Smiles

    NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0127565
1 EachQM-0127565
£0.00/ea
£0.00
£0.00/ea £0.00

GRO-alpha/CXCL1, Mouse (His)

GRO-alpha/CXCL1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.