Skip to product information
1 of 1

GRO-alpha/CXCL1, Rat

GRO-alpha/CXCL1, Rat

Size

SKU:QM-0202199-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Rat is produced in E. coli, and consists of 72 amino acids (A25-N96) .

  • Molecular Formula

    81503 (Gene_ID) P14095 (A25-K96) (Accession)

  • Smiles

    APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202199-01
2 µgQM-0202199-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0202199-02
10 µgQM-0202199-02
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0202199-03
50 µgQM-0202199-03
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GRO-alpha/CXCL1, Rat

GRO-alpha/CXCL1, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.