GRO-beta/CXCL2, Human

Name: GRO-beta/CXCL2, Human
Brand: QuantiMol
SKU: QM-0194322-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0194322-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107) .
Molecular Formula
2920 (Gene_ID) P19875 (A35-N107) (Accession)
Smiles
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0194322-01	10 µgQM-0194322-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0194322-02	50 µgQM-0194322-02 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

100 µgQM-0194322-03	100 µgQM-0194322-03 £576.10/ea	£0.00	Quantity	£576.10/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GRO-beta/CXCL2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.