Skip to product information
1 of 1

Growth Hormone R/GHR, Human (HEK293, hFc)

Growth Hormone R/GHR, Human (HEK293, hFc)

Size

SKU:QM-0205593-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (HEK293, hFc) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    2690 (Gene_ID) P10912-1 (A27-Y264) (Accession)

  • Smiles

    AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205593-01
2 µgQM-0205593-01
£58.12/ea
£0.00
£58.12/ea £0.00
5 µgQM-0205593-02
5 µgQM-0205593-02
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0205593-03
10 µgQM-0205593-03
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0205593-04
50 µgQM-0205593-04
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0205593-05
100 µgQM-0205593-05
£492.26/ea
£0.00
£492.26/ea £0.00
500 µgQM-0205593-06
500 µgQM-0205593-06
£1,323.32/ea
£0.00
£1,323.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Growth Hormone R/GHR, Human (HEK293, hFc)

Growth Hormone R/GHR, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.