Skip to product information
1 of 1

GSTP1, Human (P.pastoris, His)

GSTP1, Human (P.pastoris, His)

Size

SKU:QM-0125396

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (P.pastoris, His) is the recombinant human-derived GSTP1 protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    2950 (Gene_ID) P09211 (P2-Q210) (Accession)

  • Smiles

    PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0125396
1 EachQM-0125396
£0.00/ea
£0.00
£0.00/ea £0.00

GSTP1, Human (P.pastoris, His)

GSTP1, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.