GSTP1, Human (P.pastoris, His)
GSTP1, Human (P.pastoris, His)
SKU:QM-0125396
Request quote or documents

Product Details
-
Description
The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (P.pastoris, His) is the recombinant human-derived GSTP1 protein, expressed by P. pastoris , with N-His labeled tag.
-
Molecular Formula
2950 (Gene_ID) P09211 (P2-Q210) (Accession)
-
Smiles
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
GSTP1, Human (P.pastoris, His)
GSTP1, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.