Skip to product information
1 of 1

GSTT2B, Human (HEK293, His)

GSTT2B, Human (HEK293, His)

Size

SKU:QM-0196677-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    653689 (Gene_ID) P0CG29 (M1-P244) (Accession)

  • Smiles

    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARI

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0196677-01
5 µgQM-0196677-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0196677-02
10 µgQM-0196677-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0196677-03
50 µgQM-0196677-03
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GSTT2B, Human (HEK293, His)

GSTT2B, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.