Skip to product information
1 of 1

GYPA/CD235a, Human (GST)

GYPA/CD235a, Human (GST)

Size

SKU:QM-0082923

Price on request
Quantity

Request quote or documents

View full details
  • Description

    GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (GST) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

  • Smiles

    LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0082923
1 EachQM-0082923
£0.00/ea
£0.00
£0.00/ea £0.00

GYPA/CD235a, Human (GST)

GYPA/CD235a, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.