Skip to product information
1 of 1

GZMA/Granzyme A, Mouse (His)

GZMA/Granzyme A, Mouse (His)

Size

SKU:QM-0026090

Price on request
Quantity

Request quote or documents

View full details
  • Description

    GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    14938 (Gene_ID) P11032 (I29-V260) (Accession)

  • Smiles

    IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026090
1 EachQM-0026090
£0.00/ea
£0.00
£0.00/ea £0.00

GZMA/Granzyme A, Mouse (His)

GZMA/Granzyme A, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.