GZMA/Granzyme A, Mouse (His)
GZMA/Granzyme A, Mouse (His)
SKU:QM-0026090
Request quote or documents

Product Details
-
Description
GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.
-
Molecular Formula
14938 (Gene_ID) P11032 (I29-V260) (Accession)
-
Smiles
IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
GZMA/Granzyme A, Mouse (His)
GZMA/Granzyme A, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.