Skip to product information
1 of 1

H2BC11, Human

H2BC11, Human

Size

SKU:QM-0135349

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    8970 (Gene_ID) P06899 (P2-K126) (Accession)

  • Smiles

    PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0135349
1 EachQM-0135349
£0.00/ea
£0.00
£0.00/ea £0.00

H2BC11, Human

H2BC11, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.