H2BC11, Human
H2BC11, Human
SKU:QM-0135349
Request quote or documents

Product Details
-
Description
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
-
Molecular Formula
8970 (Gene_ID) P06899 (P2-K126) (Accession)
-
Smiles
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
H2BC11, Human
H2BC11, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.