HABP1/C1QBP, Mouse (His)

Name: HABP1/C1QBP, Mouse (His)
Brand: QuantiMol
SKU: QM-0203574-01
Price: 122.0 GBP
Availability: InStock

Size 5 µg 10 µg 20 µg 50 µg

SKU:QM-0203574-01

£122.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The HABP1/C1QBP proteins are part of the MAM33 family, related to a unique family of proteins known for unique characteristics and functions. Among the MAM33 family, HABP1 may play an important role in related cellular processes, but its specific function still needs to be explored. HABP1/C1QBP Protein, Mouse (His) is the recombinant mouse-derived HABP1/C1QBP protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
12261 (Gene_ID) Q8R5L1 (L72-Q279) (Accession)
Smiles
LHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ
Purity
95.3
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203574-01	5 µgQM-0203574-01 £122.00/ea	£0.00	Quantity	£122.00/ea	£0.00

10 µgQM-0203574-02	10 µgQM-0203574-02 £172.63/ea	£0.00	Quantity	£172.63/ea	£0.00

20 µgQM-0203574-03	20 µgQM-0203574-03 £285.19/ea	£0.00	Quantity	£285.19/ea	£0.00

50 µgQM-0203574-04	50 µgQM-0203574-04 £429.78/ea	£0.00	Quantity	£429.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HABP1/C1QBP, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.