HAI-2, Mouse (HEK293, His)

Name: HAI-2, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0075852-01
Price: 81.92 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0075852-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
20733 (Gene_ID) Q9WU03-2 /NP_001076017.1 (A28-K140) (Accession)
Smiles
ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0075852-01	5 µgQM-0075852-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0075852-02	10 µgQM-0075852-02 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0075852-03	50 µgQM-0075852-03 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

100 µgQM-0075852-04	100 µgQM-0075852-04 £597.97/ea	£0.00	Quantity	£597.97/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HAI-2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.