Haptoglobin, Mouse (His)

Name: Haptoglobin, Mouse (His)
Brand: QuantiMol
SKU: QM-0184483-01
Price: 199.44 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0184483-01

£199.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Haptoglobin Protein, Mouse (His) is the recombinant mouse-derived Haptoglobin, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
15439 (Gene_ID) Q61646 (V19-N347) (Accession)
Smiles
VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184483-01	10 µgQM-0184483-01 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0184483-02	50 µgQM-0184483-02 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0184483-03	100 µgQM-0184483-03 £658.72/ea	£0.00	Quantity	£658.72/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Haptoglobin, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.