HAS2, Mouse (His)

Name: HAS2, Mouse (His)
Brand: QuantiMol
SKU: QM-0184857-01
Price: 199.44 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg 500 µg

SKU:QM-0184857-01

£199.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
15117 (Gene_ID) P70312 (E67-L374) (Accession)
Smiles
EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0184857-01	20 µgQM-0184857-01 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0184857-02	50 µgQM-0184857-02 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

100 µgQM-0184857-03	100 µgQM-0184857-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

500 µgQM-0184857-04	500 µgQM-0184857-04 £1,433.88/ea	£0.00	Quantity	£1,433.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HAS2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.