Skip to product information
1 of 1

HAS2, Mouse (His)

HAS2, Mouse (His)

Size

SKU:QM-0184857-01

£199.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    15117 (Gene_ID) P70312 (E67-L374) (Accession)

  • Smiles

    EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0184857-01
20 µgQM-0184857-01
£199.44/ea
£0.00
£199.44/ea £0.00
50 µgQM-0184857-02
50 µgQM-0184857-02
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0184857-03
100 µgQM-0184857-03
£580.96/ea
£0.00
£580.96/ea £0.00
500 µgQM-0184857-04
500 µgQM-0184857-04
£1,433.88/ea
£0.00
£1,433.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HAS2, Mouse (His)

HAS2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.