Skip to product information
1 of 1

HB-EGF, Human (HEK293, His)

HB-EGF, Human (HEK293, His)

Size

SKU:QM-0195591-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1839 (Gene_ID) Q99075 (L20-L148) (Accession)

  • Smiles

    LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0195591-01
10 µgQM-0195591-01
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0195591-02
50 µgQM-0195591-02
£227.39/ea
£0.00
£227.39/ea £0.00
100 µgQM-0195591-03
100 µgQM-0195591-03
£316.08/ea
£0.00
£316.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HB-EGF, Human (HEK293, His)

HB-EGF, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.