HBP1, Human (His)

Name: HBP1, Human (His)
Brand: QuantiMol
SKU: QM-0076915-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0076915-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.
Molecular Formula
26959 (Gene_ID) O60381 (P208-F345) (Accession)
Smiles
PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0076915-01	5 µgQM-0076915-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0076915-02	10 µgQM-0076915-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0076915-03	50 µgQM-0076915-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0076915-04	100 µgQM-0076915-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HBP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.