Skip to product information
1 of 1

HDHD2, Human (His)

HDHD2, Human (His)

Size

SKU:QM-0108003

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)

  • Smiles

    MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0108003
1 EachQM-0108003
£0.00/ea
£0.00
£0.00/ea £0.00

HDHD2, Human (His)

HDHD2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.