HDHD2, Human (His)
HDHD2, Human (His)
SKU:QM-0108003
Request quote or documents

Product Details
-
Description
Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)
-
Smiles
MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
HDHD2, Human (His)
HDHD2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.