Skip to product information
1 of 1

HEMK2, Human (His)

HEMK2, Human (His)

Size

SKU:QM-0199967-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    29104 (Gene_ID) Q9Y5N5-2 (M1-S186) (Accession)

  • Smiles

    MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

  • Purity

    96.4

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199967-01
5 µgQM-0199967-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0199967-02
10 µgQM-0199967-02
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0199967-03
50 µgQM-0199967-03
£193.37/ea
£0.00
£193.37/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HEMK2, Human (His)

HEMK2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.