Skip to product information
1 of 1

HER3, Human (Biotinylated, HEK293, His-Avi)

HER3, Human (Biotinylated, HEK293, His-Avi)

Size

SKU:QM-0104116-01

£437.58 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived HER3 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    2065 (Gene_ID) P21860-1 (S20-T643) (Accession)

  • Smiles

    SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0104116-01
20 µgQM-0104116-01
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0104116-02
100 µgQM-0104116-02
£1,085.18/ea
£0.00
£1,085.18/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HER3, Human (Biotinylated, HEK293, His-Avi)

HER3, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.