Skip to product information
1 of 1

HER3, Rat (HEK293, His)

HER3, Rat (HEK293, His)

Size

SKU:QM-0205978-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Rat (HEK293, His) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    29496 (Gene_ID) G3V6N1/XP_017450189.1 (S20-H641) (Accession)

  • Smiles

    SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205978-01
2 µgQM-0205978-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0205978-02
5 µgQM-0205978-02
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0205978-03
10 µgQM-0205978-03
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0205978-04
50 µgQM-0205978-04
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0205978-05
100 µgQM-0205978-05
£370.76/ea
£0.00
£370.76/ea £0.00
500 µgQM-0205978-06
500 µgQM-0205978-06
£946.67/ea
£0.00
£946.67/ea £0.00
1 mgQM-0205978-07
1 mgQM-0205978-07
£1,488.56/ea
£0.00
£1,488.56/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HER3, Rat (HEK293, His)

HER3, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.