HIN-1/SCGB3A1, Human (HEK293, Fc)

Name: HIN-1/SCGB3A1, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0204098-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204098-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
HIN-1/SCGB3A1, a secreted cytokine-like protein, inhibits in vitro cell growth. Structurally, it forms a homodimer held together by disulfide bonds, emphasizing its functional arrangement. HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) is the recombinant human-derived HIN-1/SCGB3A1 protein, expressed by HEK293 , with C-mFc labeled tag.
Molecular Formula
92304 (Gene_ID) Q96QR1/NP_443095.2 (F21-G104) (Accession)
Smiles
FLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Purity
95.2
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204098-01	5 µgQM-0204098-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0204098-02	10 µgQM-0204098-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0204098-03	50 µgQM-0204098-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0204098-04	100 µgQM-0204098-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HIN-1/SCGB3A1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.