HIST3H2A, Human

Name: HIST3H2A, Human
Brand: QuantiMol
SKU: QM-0204022-01
Price: 99.25 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204022-01

£99.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free.
Molecular Formula
92815 (Gene_ID) Q7L7L0 (S2-K130) (Accession)
Smiles
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204022-01	5 µgQM-0204022-01 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

10 µgQM-0204022-02	10 µgQM-0204022-02 £149.88/ea	£0.00	Quantity	£149.88/ea	£0.00

50 µgQM-0204022-03	50 µgQM-0204022-03 £427.87/ea	£0.00	Quantity	£427.87/ea	£0.00

100 µgQM-0204022-04	100 µgQM-0204022-04 £691.52/ea	£0.00	Quantity	£691.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HIST3H2A, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.