Histone H2B 1.1, Xenopus laevis

Name: Histone H2B 1.1, Xenopus laevis
Brand: QuantiMol
SKU: QM-0088860-01
Price: 260.19 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0088860-01

£260.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free.
Molecular Formula
446588 (Gene_ID) P02281 (A5-K126) (Accession)
Smiles
AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0088860-01	10 µgQM-0088860-01 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0088860-02	50 µgQM-0088860-02 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Histone H2B 1.1, Xenopus laevis is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.