Histone H3, Human

Name: Histone H3, Human
Brand: QuantiMol
SKU: QM-0183328-01
Price: 222.53 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0183328-01

£222.53 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human is the recombinant human-derived Histone H3 protein, expressed by E. coli , with tag free.
Molecular Formula
8350 (Gene_ID) P68431 (A2-A136) (Accession)
Smiles
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0183328-01	10 µgQM-0183328-01 £222.53/ea	£0.00	Quantity	£222.53/ea	£0.00

50 µgQM-0183328-02	50 µgQM-0183328-02 £531.14/ea	£0.00	Quantity	£531.14/ea	£0.00

100 µgQM-0183328-03	100 µgQM-0183328-03 £825.17/ea	£0.00	Quantity	£825.17/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Histone H3, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.