Skip to product information
1 of 1

HLA-A, Human (His)

HLA-A, Human (His)

Size

SKU:QM-0077802-01

£79.85 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HLA-A protein is an antigen-presenting MHCI molecule that is critical for mediating reproductive and antiviral immunity. It partners with B2M to provide self- and viral peptides as ligands that inhibit and activate KIR on NK cells. HLA-A Protein, Human (His) is the recombinant human-derived HLA-A protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3105 (Gene_ID) P04439-1 (G25-I308) (Accession)

  • Smiles

    GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0077802-01
2 µgQM-0077802-01
£79.85/ea
£0.00
£79.85/ea £0.00
10 µgQM-0077802-02
10 µgQM-0077802-02
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0077802-03
50 µgQM-0077802-03
£387.77/ea
£0.00
£387.77/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HLA-A, Human (His)

HLA-A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.