Skip to product information
1 of 1

HLA-DRB1, Human (Myc, His-SUMO)

HLA-DRB1, Human (Myc, His-SUMO)

Size

SKU:QM-0104799-01

£232.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HLA-DRB1 protein, as the beta chain of MHCII, guides T cell recognition, orchestrates immune responses against pathogens and tumors, and adapts its antigen presentation in the tumor microenvironment, ensuring a diverse role in immune responses and tolerance mechanisms, notably influenced by specific alleles like DRB1*01:01. HLA-DRB1 Protein, Human (Myc, His-SUMO) is the recombinant human-derived HLA-DRB1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

  • Molecular Formula

    3123 (Gene_ID) P01911 (G30-K227) (Accession)

  • Smiles

    GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

  • Purity

    94

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0104799-01
20 µgQM-0104799-01
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0104799-02
50 µgQM-0104799-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HLA-DRB1, Human (Myc, His-SUMO)

HLA-DRB1, Human (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.