Skip to product information
1 of 1

HLP2/HPCAL1, Human (His)

HLP2/HPCAL1, Human (His)

Size

SKU:QM-0087078

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3241 (Gene_ID) P37235 (M1-F193) (Accession)

  • Smiles

    MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0087078
1 EachQM-0087078
£0.00/ea
£0.00
£0.00/ea £0.00

HLP2/HPCAL1, Human (His)

HLP2/HPCAL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.