HLP2/HPCAL1, Human (His)
HLP2/HPCAL1, Human (His)
SKU:QM-0087078
Request quote or documents

Product Details
-
Description
The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
3241 (Gene_ID) P37235 (M1-F193) (Accession)
-
Smiles
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
HLP2/HPCAL1, Human (His)
HLP2/HPCAL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.