Name: HMGB1/HMG-1, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205775-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag.
Molecular Formula
15289 (Gene_ID) P63158 (M1-E215) (Accession)
Smiles
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205775-01	5 µgQM-0205775-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205775-02	10 µgQM-0205775-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205775-03	50 µgQM-0205775-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0205775-04	100 µgQM-0205775-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205775-05	500 µgQM-0205775-05 £1,433.88/ea	£0.00	Quantity	£1,433.88/ea	£0.00

1 mgQM-0205775-06	1 mgQM-0205775-06 £2,207.84/ea	£0.00	Quantity	£2,207.84/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

HMGB1/HMG-1, Mouse (HEK293, Fc)

HMGB1/HMG-1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.