Skip to product information
1 of 1

HNMT, Human (His)

HNMT, Human (His)

Size

SKU:QM-0195594-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    3176 (Gene_ID) AAH20677.1 (M1-A292) (Accession)

  • Smiles

    MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195594-01
5 µgQM-0195594-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0195594-02
10 µgQM-0195594-02
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0195594-03
50 µgQM-0195594-03
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HNMT, Human (His)

HNMT, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.