Skip to product information
1 of 1

HNRNPA2B1, Mouse (His-SUMO, Myc)

HNRNPA2B1, Mouse (His-SUMO, Myc)

Size

SKU:QM-0201147-01

£115.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

  • Molecular Formula

    53379 (Gene_ID) O88569 (M1-Y353) (Accession)

  • Smiles

    MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201147-01
5 µgQM-0201147-01
£115.00/ea
£0.00
£115.00/ea £0.00
10 µgQM-0201147-02
10 µgQM-0201147-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0201147-03
50 µgQM-0201147-03
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HNRNPA2B1, Mouse (His-SUMO, Myc)

HNRNPA2B1, Mouse (His-SUMO, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.