Skip to product information
1 of 1

HSF1, Human (His)

HSF1, Human (His)

Size

SKU:QM-0193871-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    HSF1 is a stress-inducible transcription factor that coordinates the heat shock response by binding to the heat shock element (HSE) and activating heat shock genes. In unstressed cells, it remains inactive in multichaperone complexes. HSF1 Protein, Human (His) is the recombinant human-derived HSF1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3297 (Gene_ID) Q00613-1 (D2-S529) (Accession)

  • Smiles

    DLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0193871-01
5 µgQM-0193871-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0193871-02
10 µgQM-0193871-02
£109.38/ea
£0.00
£109.38/ea £0.00
50 µgQM-0193871-03
50 µgQM-0193871-03
£305.15/ea
£0.00
£305.15/ea £0.00
100 µgQM-0193871-04
100 µgQM-0193871-04
£470.39/ea
£0.00
£470.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HSF1, Human (His)

HSF1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.