Skip to product information
1 of 1

HSP27/HSPB1, Human (His)

HSP27/HSPB1, Human (His)

Size

SKU:QM-0202748-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

  • Smiles

    MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202748-01
5 µgQM-0202748-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0202748-02
10 µgQM-0202748-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0202748-03
50 µgQM-0202748-03
£342.81/ea
£0.00
£342.81/ea £0.00
100 µgQM-0202748-04
100 µgQM-0202748-04
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

HSP27/HSPB1, Human (His)

HSP27/HSPB1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.