Skip to product information
1 of 1

HSPB11, Human (His)

HSPB11, Human (His)

Size

SKU:QM-0111005

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    51668 (Gene_ID) Q9Y547 (M1-S144) (Accession)

  • Smiles

    MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0111005
1 EachQM-0111005
£0.00/ea
£0.00
£0.00/ea £0.00

HSPB11, Human (His)

HSPB11, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.