Skip to product information
1 of 1

HSPB2, Human (His)

HSPB2, Human (His)

Size

SKU:QM-0115702

Price on request
Quantity

Request quote or documents

View full details
  • Description

    HSPB2 Protein potentially regulates the kinase DMPK, enhancing its activity and influencing cellular processes. The specific mechanisms and broader implications in cellular signaling pathways require elucidation. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades. HSPB2 Protein, Human (His) is the recombinant human-derived HSPB2 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    3316 (Gene_ID) Q16082 (M1-P182) (Accession)

  • Smiles

    MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0115702
1 EachQM-0115702
£0.00/ea
£0.00
£0.00/ea £0.00

HSPB2, Human (His)

HSPB2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.