1 1

Human IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Human IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Size

QM-0204933-01

£67.44 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. Human IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His) is a recombinant protein dimer complex containing mouse, human-derived Human IL-23 alpha & Mouse IL-12 beta Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    51561&16160 (Gene_ID) Q9NPF7 (R20-P189) &P43432 (M23-S335) (Accession)

  • Smiles

    RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0204933-01
2 µgQM-0204933-01
£67.44/ea		 £0.00
£67.44/ea £0.00
10 µgQM-0204933-02
10 µgQM-0204933-02
£188.51/ea		 £0.00
£188.51/ea £0.00
50 µgQM-0204933-03
50 µgQM-0204933-03
£437.58/ea		 £0.00
£437.58/ea £0.00
100 µgQM-0204933-04
100 µgQM-0204933-04
£708.53/ea		 £0.00
£708.53/ea £0.00
500 µgQM-0204933-05
500 µgQM-0204933-05
£1,894.37/ea		 £0.00
£1,894.37/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Human IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Human IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.