Skip to product information
1 of 1

HVEM/TNFRSF14, Rhesus macaque (HEK293, Fc)

HVEM/TNFRSF14, Rhesus macaque (HEK293, Fc)

Size

SKU:QM-0100815

Price on request
Quantity

Request quote or documents

View full details
  • Description

    HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF) . HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation[2][3]. HVEM/TNFRSF14 Protein, Rhesus macaque (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 167 amino acids (P37-V203) and is produced in HEK293 cells.

  • Molecular Formula

    102137807 (Gene_ID) A0A2K5W0R1/XP_005545061.1 (P37-V203) (Accession)

  • Smiles

    PALPSCKEDEYPVGSECCPKCGPGFHVRQACGEQTGTVCEPCSPGTYIAHFNGLSKCLQCQMCDPAMGLRTSRNCSTTANALCGCSPGHFCIIQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSSNGTLEECQHGTKCSKWLVTEAGPGTSSFRWV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0100815
1 EachQM-0100815
£0.00/ea
£0.00
£0.00/ea £0.00

HVEM/TNFRSF14, Rhesus macaque (HEK293, Fc)

HVEM/TNFRSF14, Rhesus macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.