I-309/CCL1, Human

Name: I-309/CCL1, Human
Brand: QuantiMol
SKU: QM-0203460-01
Price: 78.82 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203460-01

£78.82 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL1 Protein, Human is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human is a recombinant human CCL1 (K24-K96) expressed by E. coli[1].
Molecular Formula
6346 (Gene_ID) P22362 (K24-K96) (Accession)
Smiles
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203460-01	2 µgQM-0203460-01 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

10 µgQM-0203460-02	10 µgQM-0203460-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0203460-03	50 µgQM-0203460-03 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

100 µgQM-0203460-04	100 µgQM-0203460-04 £896.86/ea	£0.00	Quantity	£896.86/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

I-309/CCL1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.