Skip to product information
1 of 1

IBSP, Human (His-SUMO)

IBSP, Human (His-SUMO)

Size

SKU:QM-0175896-01

£205.52 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IBSP protein has a strong affinity for hydroxyapatite and plays a crucial role in mineralized matrix formation, indicating its overall nature in this regard. Its tight binding suggests an important role in cell-matrix interactions, particularly in promoting RGD-dependent cell attachment. IBSP Protein, Human (His-SUMO) is the recombinant human-derived IBSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    3381 (Gene_ID) P21815 (A129-E281) (Accession)

  • Smiles

    AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

  • Purity

    92

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0175896-01
20 µgQM-0175896-01
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0175896-02
50 µgQM-0175896-02
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0175896-03
100 µgQM-0175896-03
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IBSP, Human (His-SUMO)

IBSP, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.