Skip to product information
1 of 1

ICOS, Human (HEK293, Fc)

ICOS, Human (HEK293, Fc)

Size

SKU:QM-0171461-01

£217.67 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    29851 (Gene_ID) Q9Y6W8-1 (E21-F141) (Accession)

  • Smiles

    EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

  • Purity

    97.43

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171461-01
10 µgQM-0171461-01
£217.67/ea
£0.00
£217.67/ea £0.00
50 µgQM-0171461-02
50 µgQM-0171461-02
£520.20/ea
£0.00
£520.20/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ICOS, Human (HEK293, Fc)

ICOS, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.