Skip to product information
1 of 1

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

Size

SKU:QM-0202784-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S mutation.

  • Molecular Formula

    54167 (Gene_ID) Q9WVS0 (E21-L144, C137S, C138S) (Accession)

  • Smiles

    EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202784-01
5 µgQM-0202784-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202784-02
10 µgQM-0202784-02
£80.89/ea
£0.00
£80.89/ea £0.00
50 µgQM-0202784-03
50 µgQM-0202784-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0202784-04
100 µgQM-0202784-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.