ICOS, Rhesus Macaque (HEK293, Fc)
ICOS, Rhesus Macaque (HEK293, Fc)
SKU:QM-0102961
Request quote or documents

Product Details
-
Description
ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
705788 (Gene_ID) H9Z062 (G20-K140) (Accession)
-
Smiles
GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
ICOS, Rhesus Macaque (HEK293, Fc)
ICOS, Rhesus Macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.