Skip to product information
1 of 1

ICOS, Rhesus Macaque (HEK293, Fc)

ICOS, Rhesus Macaque (HEK293, Fc)

Size

SKU:QM-0102961

Price on request
Quantity

Request quote or documents

View full details
  • Description

    ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    705788 (Gene_ID) H9Z062 (G20-K140) (Accession)

  • Smiles

    GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0102961
1 EachQM-0102961
£0.00/ea
£0.00
£0.00/ea £0.00

ICOS, Rhesus Macaque (HEK293, Fc)

ICOS, Rhesus Macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.