Skip to product information
1 of 1

IDUA, Human (His)

IDUA, Human (His)

Size

SKU:QM-0202557-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IDUA Protein, with catalytic activity, hydrolyzes unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. Its enzymatic function is crucial in breaking down these specific bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis. IDUA Protein, Human (His) is the recombinant human-derived IDUA protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3425 (Gene_ID) P35475-1 (A28-P653) (Accession)

  • Smiles

    APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202557-01
5 µgQM-0202557-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0202557-02
10 µgQM-0202557-02
£122.88/ea
£0.00
£122.88/ea £0.00
20 µgQM-0202557-03
20 µgQM-0202557-03
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0202557-04
50 µgQM-0202557-04
£320.94/ea
£0.00
£320.94/ea £0.00
100 µgQM-0202557-05
100 µgQM-0202557-05
£476.46/ea
£0.00
£476.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IDUA, Human (His)

IDUA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.